Tested for
WB
Cross Reactivity
Human
Raised in
Rabbit
Concentration
1 mg/ml
Shipping conditions
Blue Ice
French translation
anticorps
Usage Recommendations
WB: 1 ug/ml
Category
Primary Antibody
Method of Purification
Affinity purified
Area of research
Cytokines & Growth Factors
Antibody Subtype
Polyclonal Antibodies, Purified
Specificity
GDF15 antibody was raised against the N terminal of GDF15
Form & Buffer
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GDF15 antibody in PBS
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Properties
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Assay Information
GDF15 Blocking Peptide, catalog no. 33R-1525, is also available for use as a blocking control in assays to test for specificity of this GDF15 antibody
Type of Immunogen
GDF15 antibodies were raised using the N terminal of GDF15 corresponding to a region with amino acids ASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAP
Additional Information
This is a rabbit polyclonal antibody against GDF15, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com