Tested for

WB

Cross Reactivity

Human

Raised in

Rabbit

Concentration

1 mg/ml

Shipping conditions

Blue Ice

French translation

anticorps

Usage Recommendations

WB: 1 ug/ml

Category

Primary Antibody

Method of Purification

Affinity purified

Area of research

Differentiation & Development

Antibody Subtype

Polyclonal Antibodies, Purified

Specificity

LEFTY2 antibody was raised against the N terminal of LEFTY2

Form & Buffer

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LEFTY2 antibody in PBS

Storage

Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Properties

If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Assay Information

LEFTY2 Blocking Peptide, catalog no. 33R-6619, is also available for use as a blocking control in assays to test for specificity of this LEFTY2 antibody

Type of Immunogen

LEFTY2 antibodies were raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK

Additional Information

This is a rabbit polyclonal antibody against LEFTY2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com