Tested for

WB

Raised in

Rabbit

Concentration

1 mg/ml

Shipping conditions

Blue Ice

French translation

anticorps

Cross Reactivity

Human,Mouse

Usage Recommendations

WB: 1.25 ug/ml

Category

Primary Antibody

Area of research

Cytokines & Growth Factors

Method of Purification

Total IgG Protein A purified

Antibody Subtype

Polyclonal Antibodies, Purified

Specificity

TGFBI antibody was raised against the C terminal of TGFBI

Form & Buffer

Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TGFBI antibody in PBS

Storage

Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Properties

If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Assay Information

TGFBI Blocking Peptide, catalog no. 33R-5094, is also available for use as a blocking control in assays to test for specificity of this TGFBI antibody

Type of Immunogen

TGFBI antibodies were raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA

Additional Information

This is a rabbit polyclonal antibody against TGFBI, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com