Tested for
WB
Raised in
Rabbit
Concentration
1 mg/ml
Shipping conditions
Blue Ice
French translation
anticorps
Cross Reactivity
Human,Mouse
Usage Recommendations
WB: 1.25 ug/ml
Category
Primary Antibody
Area of research
Cytokines & Growth Factors
Method of Purification
Total IgG Protein A purified
Antibody Subtype
Polyclonal Antibodies, Purified
Specificity
TGFBI antibody was raised against the C terminal of TGFBI
Form & Buffer
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TGFBI antibody in PBS
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Properties
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Assay Information
TGFBI Blocking Peptide, catalog no. 33R-5094, is also available for use as a blocking control in assays to test for specificity of this TGFBI antibody
Type of Immunogen
TGFBI antibodies were raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
Additional Information
This is a rabbit polyclonal antibody against TGFBI, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com