Analyses

Entrez GeneID

7046

Reacts with species:

human

Target antigen

TGFBR1

Raised in

rabbit

Uniprot ID

P36897

Gene Name

TGFBR1

French translation

anticorps

Product form

freeze-dried

Clonality

Polyclonal antibody

Clone

Polyclonal antibody

Type of the antibody

IgG polyclonal antibody

Protein Name

TGF-beta receptor type-1

Purification

Immunogen affinity purified.

Gene Full Name

transforming growth factor, beta receptor 1

Product configuration

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Solubilization

The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml

Properties

If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences.

Tips

The TGFBR1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.

Storage condtions

Keep the TGFBR1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.

1. Drera, B., Tadini, G., Barlati, S., Colombi, M.Identification of a novel TGFBR1 mutation in a Loeys-Dietz syndrome type II patient with vascular Ehlers-Danlos syndrome phenotype. (Letter)Clin. Genet. 73: 290-293, 2008. 2. Goudie, D. R., D'Alessandro, M., Merriman, B., Lee, H., Szeverenyi, I., Avery, S., O'Connor, B. D., Nelson, S. F., Coats, S. E., Stewart, A., Christie, L., Pichert, G., and 11 others.Multiple self-healing squamous epithelioma is caused by a disease-specific spectrum of mutations in TGFBR1.Nature Genet. 43: 365-369, 2011. 3. Vellucci, V. F., Reiss, M.Cloning and genomic organization of the human transforming growth factor-beta type I receptor gene.Genomics 46: 278-283, 1997.

Background

Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest. Vellucci and Reiss (1997) reported that the TGFBR1 gene is approximately 31 kb long and contains 9 exons. The organization of the segment of the gene that encodes the C-terminal portion of the serine/threonine kinase domain appears to be highly conserved among members of the gene family.

Synonyms

TGFBR1 Antibody

Basic information

Name

Size

Catalog number

Price