Analyses

Entrez GeneID

7048

Reacts with species:

human

Target antigen

TGFBR2

Raised in

rabbit

Uniprot ID

P37173

Gene Name

TGFBR2

French translation

anticorps

Product form

freeze-dried

Clonality

Polyclonal antibody

Clone

Polyclonal antibody

Type of the antibody

IgG polyclonal antibody

Protein Name

TGF-beta receptor type-2

Purification

Immunogen affinity purified.

Gene Full Name

transforming growth factor, beta receptor II (70/80kDa)

Product configuration

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Solubilization

The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml

Properties

If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Tips

The TGFBR2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.

Storage condtions

Keep the TGFBR2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.

1. Hagen, G., Muller, S., Beato, M., Suske, G. Cloning by recognition site screening of two novel GT box binding proteins: a family of Sp1 related genes. Nucleic Acids Res. 20: 5519-5525, 1992. 2. Lin, H. Y., Wang, X.-F., Ng-Eaton, E., Weinberg, R. A., Lodish, H. F. Expression cloning of the TGF-beta type II receptor, a functional transmembrane serine/threonine kinase. Cell 68: 775-785, 1992. 3. Hahm, K.-B., Cho, K., Lee, C., Im, Y.-H., Chang, J., Choi, S.-G., Sorensen, P. H. B., Thiele, C. J., Kim, S.-J.Repression of the gene encoding the TGF-beta type II receptor is a major target of the EWS-FLI1 oncoprotein. Nature Genet. 23: 222-227, 1999.

Synonyms

Background

TGFBR2 (transforming growth factor, beta receptor II (70/80kDa)), also known as TGF-beta receptor type-2, TGFR-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II( TGF-beta receptor type II, TbetaR-II), is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. A TGFBR2 cDNA encodes a deduced 565-amino acid protein with a calculated molecular mass of approximately 60 kD in length. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.

TGFBR2 Antibody

Basic information

Name

Size

Catalog number

Price