TGFBR1 Antibody

WB

7046

TGFBR1

rabbit

P36897

TGFBR1

anticorps

human, rat

freeze-dried

Polyclonal antibody

Polyclonal antibody

IgG polyclonal antibody

TGF-beta receptor type-1

Immunogen affinity purified.

transforming growth factor, beta receptor 1

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml

If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences.

The TGFBR1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.

AAT5 | ALK 5 | ALK5 | ALK-5 | MSSE | SKR 4 | SKR4 | TbetaR I | TbetaR-I | tgf b receptor i | TGF beta Receptor I | TGF beta receptor type 1 | TGF beta receptor type I | TGF beta type I receptor | TGF-beta receptor type I | TGF-beta receptor type-1 | TGF-beta type I receptor | TGFBR 1 | TGFBR1 protein | TGFR 1 | TGFR1 | TGFR-1 | P36897

Keep the TGFBR1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.

Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest.

1. Drera, B., Tadini, G., Barlati, S., Colombi, M.Identification of a novel TGFBR1 mutation in a Loeys-Dietz syndrome type II patient with vascular Ehlers-Danlos syndrome phenotype. (Letter)Clin. Genet. 73: 290-293, 2008. 2. Goudie, D. R., D'Alessandro, M., Merriman, B., Lee, H., Szeverenyi, I., Avery, S., O'Connor, B. D., Nelson, S. F., Coats, S. E., Stewart, A., Christie, L., Pichert, G., and 11 others.Multiple self-healing squamous epithelioma is caused by a disease-specific spectrum of mutations in TGFBR1.Nature Genet. 43: 365-369, 2011. 3. Vellucci, V. F., Reiss, M.Cloning and genomic organization of the human transforming growth factor-beta type I receptor gene.Genomics 46: 278-283, 1997.